PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462907302
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 434aa    MW: 49119.8 Da    PI: 10.0565
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462907302genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B358.41.3e-1871159197
                EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                ffkv+ p  +++  rl +p +f+ ++ ++++ +   ++l+ +sg++W+  l  +   ++  +t+GWkeFv ++ L++g f+vF++dg+sef   v vf
  462907302  71 FFKVFFPQQSGE--RLKIPQSFC-KYlKEEPSR--PISLKGPSGNTWQAML--TSVEEGLGFTQGWKEFVGDHSLQQGHFLVFTYDGHSEF--SVLVF 159
                889997777776..59*******.663656555..5***************..99999999*************************99999..55555 PP

2B352.87e-17329420398
                EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
         B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                +v++ s+v     + +p +fa+e   + ++ k++tl d++g+ Wev++ y   ++   +++GW +F+  n+L+  D++vF+l ++++   +v+++r
  462907302 329 QVMMESYVYVGFFMNIPCEFAREWL-P-RTCKKMTLWDPQGKPWEVQYVYYSERSVAAFSGGWGKFAVGNNLEKFDVCVFELLKDDNI--KVHIYR 420
                68999****************9995.3.4568****************9988888899***********************9875544..787776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086313.80369162IPR003340B3 DNA binding domain
SuperFamilySSF1019361.55E-2269163IPR015300DNA-binding pseudobarrel domain
CDDcd100172.51E-1869160No hitNo description
Gene3DG3DSA:2.40.330.103.4E-2469163IPR015300DNA-binding pseudobarrel domain
PfamPF023622.2E-1671158IPR003340B3 DNA binding domain
SMARTSM010198.1E-1671163IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.6E-25318420IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.44E-24320420IPR015300DNA-binding pseudobarrel domain
CDDcd100172.98E-24325420No hitNo description
PROSITE profilePS5086313.338327422IPR003340B3 DNA binding domain
SMARTSM010191.9E-13327422IPR003340B3 DNA binding domain
PfamPF023623.1E-15329420IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MARENQQQQG ISSAAAAAKE RSMRKGKESG MEKQKEKGTE ERKEKGTEKR KSKKGRAEAR  60
KGDTVGAGHH FFKVFFPQQS GERLKIPQSF CKYLKEEPSR PISLKGPSGN TWQAMLTSVE  120
EGLGFTQGWK EFVGDHSLQQ GHFLVFTYDG HSEFSVLVFC KSGVEDESAL DARPSKERVV  180
KEEEEEGAQD ADAAGASERE ASALPSVEGN GKTRKRARQG MVNSSTPKRR LSVQNKPEKR  240
KPEAFVDTSK AVSTVPDSNK DFSCMLDEYS SYNKSLSTRK DVPRMGKAVS KKSRQPVVIS  300
QRRRITDEEK AHALKTAKEF KSKNPFTLQV MMESYVYVGF FMNIPCEFAR EWLPRTCKKM  360
TLWDPQGKPW EVQYVYYSER SVAAFSGGWG KFAVGNNLEK FDVCVFELLK DDNIKVHIYR  420
VVPEVTPLLR KRSM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A1e-1530042122142B3 domain-containing transcription factor VRN
4i1k_B1e-1530042122142B3 domain-containing transcription factor VRN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978926.11e-160PREDICTED: B3 domain-containing protein Os11g0197600-like
SwissprotQ2R9D21e-128Y1176_ORYSJ; B3 domain-containing protein Os11g0197600
TrEMBLA0A0A9DCS31e-166A0A0A9DCS3_ARUDO; Uncharacterized protein
STRINGSi027380m1e-151(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44613766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.15e-24B3 family protein